PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG470300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 190aa    MW: 21365.6 Da    PI: 8.1353
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG470300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.81.2e-27959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krie+   rqvtfskRr g++KKAeELSvLCda+va+i+fsstgkl  ++s
  Pavir.1NG470300.2.p  9 KRIESAAARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSTGKLSQFAS 59
                         79*********************************************9986 PP

2K-box49.61.6e-17911551983
                K-box  19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83 
                           ++a L++++ +    +R++ Ge+Le Ls++eLqqLe++Le +l ++ ++K++ +leqi elq+k
  Pavir.1NG470300.2.p  91 SKYASLNEQLAEASLRLRQMRGEELEGLSVEELQQLEKNLEAGLHRVLQTKDQQFLEQIGELQRK 155
                          45666777777777899***********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.623161IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-36160IPR002100Transcription factor, MADS-box
CDDcd002651.47E-39275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-30374IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-25323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-253859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.93786169IPR002487Transcription factor, K-box
PfamPF014863.3E-1492155IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MARERREIKR IESAAARQVT FSKRRRGLFK KAEELSVLCD ADVALIVFSS TGKLSQFASS  60
SMNEIIDKYN THSKNLGKAE PPSLDLNLEH SKYASLNEQL AEASLRLRQM RGEELEGLSV  120
EELQQLEKNL EAGLHRVLQT KDQQFLEQIG ELQRKVWIHL FNVTCSCTNT IHPLSPIILV  180
VCGKLACCL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D9e-19272171Myocyte-specific enhancer factor 2A
3mu6_C9e-19272171Myocyte-specific enhancer factor 2A
3mu6_B9e-19272171Myocyte-specific enhancer factor 2A
3mu6_A9e-19272171Myocyte-specific enhancer factor 2A
1tqe_S1e-18173173Myocyte-specific enhancer factor 2B
1tqe_R1e-18173173Myocyte-specific enhancer factor 2B
1tqe_Q1e-18173173Myocyte-specific enhancer factor 2B
1tqe_P1e-18173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.6290.0leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4306330.0AJ430633.1 Zea mays mRNA for putative MADS-domain transcription factor (m19 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953998.11e-103PREDICTED: MADS-box transcription factor 22
SwissprotQ9XJ661e-102MAD22_ORYSJ; MADS-box transcription factor 22
TrEMBLA0A096QJV11e-102A0A096QJV1_MAIZE; Uncharacterized protein
STRINGSb04g033930.11e-101(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.15e-53MIKC_MADS family protein